PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo12G0003900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 267aa    MW: 29126.1 Da    PI: 9.4517
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo12G0003900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding673.4e-212671147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l+++v+++G+++W++I+++++ gR++k+c++rw + 
  Spipo12G0003900 26 KGPWSPEEDDALKKLVQKHGPRNWSLISKHVP-GRSGKSCRLRWCNQ 71
                     79******************************.***********985 PP

2Myb_DNA-binding56.75.4e-1880122347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde++ +a++++G++ W+tIar +  gRt++ +k++w++ 
  Spipo12G0003900  80 PFTQEEDEKIMRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 122
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.8922176IPR017930Myb domain
SuperFamilySSF466893.18E-3323119IPR009057Homeodomain-like
SMARTSM007172.1E-192574IPR001005SANT/Myb domain
PfamPF002497.8E-212671IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-282779IPR009057Homeodomain-like
CDDcd001671.77E-182870No hitNo description
SMARTSM007177.2E-1577125IPR001005SANT/Myb domain
PROSITE profilePS5129421.84978127IPR017930Myb domain
CDDcd001671.19E-1280123No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2480126IPR009057Homeodomain-like
PfamPF002495.5E-1580122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MQSVAGGAVN TGGATGAARR DADRIKGPWS PEEDDALKKL VQKHGPRNWS LISKHVPGRS  60
GKSCRLRWCN QLSPQVEHRP FTQEEDEKIM RAHAKFGNKW ATIARLLSGR TDNAIKNHWN  120
STLKRKYASC GLPSAGGISC CSASVKDDVI VADDAVGGVY CKGDLIDRQE DEYSDERPLK  180
RAGSGVPVPS GGLSQPGPGK KQQQFPFSAE FLAIMEDMIK KEVKSYMLGL EHSGVTFVLP  240
QPPQKHHPFD GLRSVDVNQI EVSKLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-42251263104MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-42251263104C-Myb DNA-Binding Domain
1msf_C7e-42251263104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00632PBMTransfer from PK28565.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268121.13e-79sucrose responsive element binding protein
TrEMBLM0SQH86e-82M0SQH8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P20150_0012e-81(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-65myb domain protein 73